Anti SLITRK4 pAb (ATL-HPA000431 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000431-25

Protein Description: SLIT and NTRK-like family, member 4
Gene Name: SLITRK4
Alternative Gene Name: DKFZp547M2010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046699: 94%, ENSRNOG00000008689: 24%
Entrez Gene ID: 139065
Uniprot ID: Q8IW52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHACGLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQPDKKSKKSLIGGNHS
• Gene Sequence: PDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHACGLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQPDKKSKKSLIGGNHS
• Gene ID - Mouse: ENSMUSG00000046699
• Gene ID - Rat: ENSRNOG00000008689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.