Anti SLFN12L pAb (ATL-HPA024447)

Atlas Antibodies

Catalog No.:
ATL-HPA024447-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: schlafen family member 12-like
Gene Name: SLFN12L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000082101: 29%, ENSRNOG00000006384: 30%
Entrez Gene ID: 100506736
Uniprot ID: Q6IEE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRVKQLTEKEWIQFMVDSEPVCEELPSPASTSSPVSQSYPLREYINFKIQPLRYHLPGLSEKITCAPKTFCRNLFSQHEGLK
Gene Sequence NRVKQLTEKEWIQFMVDSEPVCEELPSPASTSSPVSQSYPLREYINFKIQPLRYHLPGLSEKITCAPKTFCRNLFSQHEGLK
Gene ID - Mouse ENSMUSG00000082101
Gene ID - Rat ENSRNOG00000006384
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLFN12L pAb (ATL-HPA024447)
Datasheet Anti SLFN12L pAb (ATL-HPA024447) Datasheet (External Link)
Vendor Page Anti SLFN12L pAb (ATL-HPA024447) at Atlas Antibodies

Documents & Links for Anti SLFN12L pAb (ATL-HPA024447)
Datasheet Anti SLFN12L pAb (ATL-HPA024447) Datasheet (External Link)
Vendor Page Anti SLFN12L pAb (ATL-HPA024447)