Anti SLC9A5 pAb (ATL-HPA041004)

Atlas Antibodies

Catalog No.: ATL-HPA041004-25

Protein Description: solute carrier family 9, subfamily A (NHE5, cation proton antiporter 5), member 5
Gene Name: SLC9A5
Alternative Gene Name: NHE5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014786: 86%, ENSRNOG00000028844: 87%
Entrez Gene ID: 6553
Uniprot ID: Q14940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPRSSFAFPPSLAKAGRSRSESSADLPQQQELQPLMGHKDHTHL
• Gene Sequence: ASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPRSSFAFPPSLAKAGRSRSESSADLPQQQELQPLMGHKDHTHL
• Gene ID - Mouse: ENSMUSG00000014786
• Gene ID - Rat: ENSRNOG00000028844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.