Anti SLC9A2 pAb (ATL-HPA035122)

Atlas Antibodies

Catalog No.:
ATL-HPA035122-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 9, subfamily A (NHE2, cation proton antiporter 2), member 2
Gene Name: SLC9A2
Alternative Gene Name: NHE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026062: 83%, ENSRNOG00000015567: 85%
Entrez Gene ID: 6549
Uniprot ID: Q9UBY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKS
Gene Sequence SLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKS
Gene ID - Mouse ENSMUSG00000026062
Gene ID - Rat ENSRNOG00000015567
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC9A2 pAb (ATL-HPA035122)
Datasheet Anti SLC9A2 pAb (ATL-HPA035122) Datasheet (External Link)
Vendor Page Anti SLC9A2 pAb (ATL-HPA035122) at Atlas Antibodies

Documents & Links for Anti SLC9A2 pAb (ATL-HPA035122)
Datasheet Anti SLC9A2 pAb (ATL-HPA035122) Datasheet (External Link)
Vendor Page Anti SLC9A2 pAb (ATL-HPA035122)