Anti SLC9A2 pAb (ATL-HPA035122)

Atlas Antibodies

Catalog No.: ATL-HPA035122-25

Protein Description: solute carrier family 9, subfamily A (NHE2, cation proton antiporter 2), member 2
Gene Name: SLC9A2
Alternative Gene Name: NHE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026062: 83%, ENSRNOG00000015567: 85%
Entrez Gene ID: 6549
Uniprot ID: Q9UBY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKS
• Gene Sequence: SLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKS
• Gene ID - Mouse: ENSMUSG00000026062
• Gene ID - Rat: ENSRNOG00000015567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.