Anti SLC9A2 pAb (ATL-HPA035121)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035121-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC9A2
Alternative Gene Name: NHE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026062: 89%, ENSRNOG00000015567: 89%
Entrez Gene ID: 6549
Uniprot ID: Q9UBY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEIKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDEIRELLSRNLYQIR |
| Gene Sequence | LEIKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDEIRELLSRNLYQIR |
| Gene ID - Mouse | ENSMUSG00000026062 |
| Gene ID - Rat | ENSRNOG00000015567 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC9A2 pAb (ATL-HPA035121) | |
| Datasheet | Anti SLC9A2 pAb (ATL-HPA035121) Datasheet (External Link) |
| Vendor Page | Anti SLC9A2 pAb (ATL-HPA035121) at Atlas Antibodies |
| Documents & Links for Anti SLC9A2 pAb (ATL-HPA035121) | |
| Datasheet | Anti SLC9A2 pAb (ATL-HPA035121) Datasheet (External Link) |
| Vendor Page | Anti SLC9A2 pAb (ATL-HPA035121) |