Anti SLC8B1 pAb (ATL-HPA040668)

Atlas Antibodies

Catalog No.: ATL-HPA040668-25

Protein Description: solute carrier family 8 (sodium/lithium/calcium exchanger), member B1
Gene Name: SLC8B1
Alternative Gene Name: FLJ22233, NCKX6, NCLX, SLC24A6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032754: 65%, ENSRNOG00000001383: 64%
Entrez Gene ID: 80024
Uniprot ID: Q6J4K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL
• Gene Sequence: RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL
• Gene ID - Mouse: ENSMUSG00000032754
• Gene ID - Rat: ENSRNOG00000001383
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC8B1 pAb (ATL-HPA040668) – 1 Found

Wang, Xianren; Zhu, Yuanping; Long, Haishan; Pan, Song; Xiong, Hao; Fang, Qiaojun; Hill, Kayla; Lai, Ruosha; Yuan, Hu; Sha, Su-Hua. Mitochondrial Calcium Transporters Mediate Sensitivity to Noise-Induced Losses of Hair Cells and Cochlear Synapses. Frontiers In Molecular Neuroscience. 11( 30670946):469.