Anti SLC7A7 pAb (ATL-HPA036227 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036227-25

Protein Description: solute carrier family 7 (amino acid transporter light chain, y+L system), member 7
Gene Name: SLC7A7
Alternative Gene Name: LPI, y+LAT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000958: 68%, ENSRNOG00000010296: 58%
Entrez Gene ID: 9056
Uniprot ID: Q9UM01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
• Gene Sequence: DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
• Gene ID - Mouse: ENSMUSG00000000958
• Gene ID - Rat: ENSRNOG00000010296
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC7A7 pAb (ATL-HPA036227 w/enhanced validation) – 1 Found

Tina, E; Prosén, S; Lennholm, S; Gasparyan, G; Lindberg, M; Göthlin Eremo, A. Expression profile of the amino acid transporters SLC7A5, SLC7A7, SLC7A8 and the enzyme TDO2 in basal cell carcinoma. The British Journal Of Dermatology. 2019;180(1):130-140.