Anti SLC6A14 pAb (ATL-HPA003193 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003193-25

Protein Description: solute carrier family 6 (amino acid transporter), member 14
Gene Name: SLC6A14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031089: 70%, ENSRNOG00000005687: 68%
Entrez Gene ID: 11254
Uniprot ID: Q9UN76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
• Gene Sequence: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
• Gene ID - Mouse: ENSMUSG00000031089
• Gene ID - Rat: ENSRNOG00000005687
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC6A14 pAb (ATL-HPA003193 w/enhanced validation) – 2 Found

Ko, Ying-Hui; Lin, Zhao; Flomenberg, Neal; Pestell, Richard G; Howell, Anthony; Sotgia, Federica; Lisanti, Michael P; Martinez-Outschoorn, Ubaldo E. Glutamine fuels a vicious cycle of autophagy in the tumor stroma and oxidative mitochondrial metabolism in epithelial cancer cells: implications for preventing chemotherapy resistance. Cancer Biology & Therapy. 2011;12(12):1085-97. 

Penheiter, Alan R; Erdogan, Sibel; Murphy, Stephen J; Hart, Steven N; Felipe Lima, Joema; Rakhshan Rohakhtar, Fariborz; O'Brien, Daniel R; Bamlet, William R; Wuertz, Ryan E; Smyrk, Thomas C; Couch, Fergus J; Vasmatzis, George; Bender, Claire E; Carlson, Stephanie K. Transcriptomic and Immunohistochemical Profiling of SLC6A14 in Pancreatic Ductal Adenocarcinoma. Biomed Research International. 2015( 26106611):593572.