Anti SLC6A11 pAb (ATL-HPA037981)

Atlas Antibodies

Catalog No.:
ATL-HPA037981-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 6 (neurotransmitter transporter), member 11
Gene Name: SLC6A11
Alternative Gene Name: GAT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030307: 85%, ENSRNOG00000005697: 87%
Entrez Gene ID: 6538
Uniprot ID: P48066
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
Gene Sequence GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
Gene ID - Mouse ENSMUSG00000030307
Gene ID - Rat ENSRNOG00000005697
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC6A11 pAb (ATL-HPA037981)
Datasheet Anti SLC6A11 pAb (ATL-HPA037981) Datasheet (External Link)
Vendor Page Anti SLC6A11 pAb (ATL-HPA037981) at Atlas Antibodies

Documents & Links for Anti SLC6A11 pAb (ATL-HPA037981)
Datasheet Anti SLC6A11 pAb (ATL-HPA037981) Datasheet (External Link)
Vendor Page Anti SLC6A11 pAb (ATL-HPA037981)