Anti SLC5A2 pAb (ATL-HPA041603 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041603-25

Protein Description: solute carrier family 5 (sodium/glucose cotransporter), member 2
Gene Name: SLC5A2
Alternative Gene Name: SGLT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030781: 89%, ENSRNOG00000020039: 91%
Entrez Gene ID: 6524
Uniprot ID: P31639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
• Gene Sequence: FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
• Gene ID - Mouse: ENSMUSG00000030781
• Gene ID - Rat: ENSRNOG00000020039
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC5A2 pAb (ATL-HPA041603 w/enhanced validation) – 2 Found

Marable, Sierra S; Chung, Eunah; Park, Joo-Seop. Hnf4a Is Required for the Development of Cdh6-Expressing Progenitors into Proximal Tubules in the Mouse Kidney. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2543-2558. 

Deacon, Patrick; Concodora, Charles W; Chung, Eunah; Park, Joo-Seop. β-catenin regulates the formation of multiple nephron segments in the mouse kidney. Scientific Reports. 2019;9(1):15915.