Anti SLC4A4 pAb (ATL-HPA035629)

Atlas Antibodies

Catalog No.: ATL-HPA035629-25

Protein Description: solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Gene Name: SLC4A4
Alternative Gene Name: hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060961: 83%, ENSRNOG00000003134: 81%
Entrez Gene ID: 8671
Uniprot ID: Q9Y6R1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTTFDWAFLSKKECSKYGGNLVGNN
• Gene Sequence: DYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTTFDWAFLSKKECSKYGGNLVGNN
• Gene ID - Mouse: ENSMUSG00000060961
• Gene ID - Rat: ENSRNOG00000003134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.