Anti SLC4A4 pAb (ATL-HPA035628 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035628-25

Protein Description: solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Gene Name: SLC4A4
Alternative Gene Name: hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060961: 95%, ENSRNOG00000003134: 93%
Entrez Gene ID: 8671
Uniprot ID: Q9Y6R1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
• Gene Sequence: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
• Gene ID - Mouse: ENSMUSG00000060961
• Gene ID - Rat: ENSRNOG00000003134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC4A4 pAb (ATL-HPA035628 w/enhanced validation) – 2 Found

Yang, Andrew C; Vest, Ryan T; Kern, Fabian; Lee, Davis P; Agam, Maayan; Maat, Christina A; Losada, Patricia M; Chen, Michelle B; Schaum, Nicholas; Khoury, Nathalie; Toland, Angus; Calcuttawala, Kruti; Shin, Heather; Pálovics, Róbert; Shin, Andrew; Wang, Elizabeth Y; Luo, Jian; Gate, David; Schulz-Schaeffer, Walter J; Chu, Pauline; Siegenthaler, Julie A; McNerney, M Windy; Keller, Andreas; Wyss-Coray, Tony. A human brain vascular atlas reveals diverse mediators of Alzheimer's risk. Nature. 2022;603(7903):885-892. 

Li, Jun Ming; Lee, Soojung; Zafar, Reda; Shin, Eunjung; Choi, Inyeong. Sodium bicarbonate transporter NBCe1 regulates proliferation and viability of human prostate cancer cells LNCaP and PC3. Oncology Reports. 2021;46(1)