Anti SLC4A1AP pAb (ATL-HPA036679)

Atlas Antibodies

Catalog No.: ATL-HPA036679-25

Protein Description: solute carrier family 4 (anion exchanger), member 1, adaptor protein
Gene Name: SLC4A1AP
Alternative Gene Name: HLC3, kanadaptin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029141: 95%, ENSRNOG00000004901: 97%
Entrez Gene ID: 22950
Uniprot ID: Q9BWU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK
• Gene Sequence: TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK
• Gene ID - Mouse: ENSMUSG00000029141
• Gene ID - Rat: ENSRNOG00000004901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.