Anti SLC38A7 pAb (ATL-HPA041777)

Atlas Antibodies

Catalog No.: ATL-HPA041777-25

Protein Description: solute carrier family 38, member 7
Gene Name: SLC38A7
Alternative Gene Name: FLJ10815
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036534: 83%, ENSRNOG00000012007: 81%
Entrez Gene ID: 55238
Uniprot ID: Q9NVC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST
• Gene Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST
• Gene ID - Mouse: ENSMUSG00000036534
• Gene ID - Rat: ENSRNOG00000012007
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC38A7 pAb (ATL-HPA041777) – 2 Found

Verdon, Quentin; Boonen, Marielle; Ribes, Christopher; Jadot, Michel; Gasnier, Bruno; Sagné, Corinne. SNAT7 is the primary lysosomal glutamine exporter required for extracellular protein-dependent growth of cancer cells. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(18):E3602-E3611. 

Xiong, Jian; Luu, Thi Thu Trang; Venkatachalam, Kartik; Du, Guangwei; Zhu, Michael X. Glutamine Produces Ammonium to Tune Lysosomal pH and Regulate Lysosomal Function. Cells. 2022;12(1)