Anti SLC38A6 pAb (ATL-HPA018508)

Atlas Antibodies

Catalog No.: ATL-HPA018508-25

Protein Description: solute carrier family 38, member 6
Gene Name: SLC38A6
Alternative Gene Name: NAT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044712: 71%, ENSRNOG00000022622: 76%
Entrez Gene ID: 145389
Uniprot ID: Q8IZM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA
• Gene Sequence: KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA
• Gene ID - Mouse: ENSMUSG00000044712
• Gene ID - Rat: ENSRNOG00000022622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC38A6 pAb (ATL-HPA018508) – 2 Found

Bagchi, Sonchita; Baomar, Hajar Ali; Al-Walai, Somar; Al-Sadi, Saifaddin; Fredriksson, Robert. Histological analysis of SLC38A6 (SNAT6) expression in mouse brain shows selective expression in excitatory neurons with high expression in the synapses. Plos One. 9(4):e95438. 

Gandasi, Nikhil R; Arapi, Vasiliki; Mickael, Michel E; Belekar, Prajakta A; Granlund, Louise; Kothegala, Lakshmi; Fredriksson, Robert; Bagchi, Sonchita. Glutamine Uptake via SNAT6 and Caveolin Regulates Glutamine-Glutamate Cycle. International Journal Of Molecular Sciences. 2021;22(3)