Anti SLC38A3 pAb (ATL-HPA031871)

Atlas Antibodies

Catalog No.:
ATL-HPA031871-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 38, member 3
Gene Name: SLC38A3
Alternative Gene Name: G17, SN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010064: 69%, ENSRNOG00000016827: 72%
Entrez Gene ID: 10991
Uniprot ID: Q99624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFHVPCPLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQT
Gene Sequence KFHVPCPLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQT
Gene ID - Mouse ENSMUSG00000010064
Gene ID - Rat ENSRNOG00000016827
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC38A3 pAb (ATL-HPA031871)
Datasheet Anti SLC38A3 pAb (ATL-HPA031871) Datasheet (External Link)
Vendor Page Anti SLC38A3 pAb (ATL-HPA031871) at Atlas Antibodies

Documents & Links for Anti SLC38A3 pAb (ATL-HPA031871)
Datasheet Anti SLC38A3 pAb (ATL-HPA031871) Datasheet (External Link)
Vendor Page Anti SLC38A3 pAb (ATL-HPA031871)