Anti SLC37A2 pAb (ATL-HPA014948)

Atlas Antibodies

Catalog No.: ATL-HPA014948-25

Protein Description: solute carrier family 37 (glucose-6-phosphate transporter), member 2
Gene Name: SLC37A2
Alternative Gene Name: FLJ00171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032122: 83%, ENSRNOG00000039390: 80%
Entrez Gene ID: 219855
Uniprot ID: Q8TED4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKPISIVKSRLHQNCSEQIKPINDTHSLNDTMWCSWAPFDKDNYKE
• Gene Sequence: RKPISIVKSRLHQNCSEQIKPINDTHSLNDTMWCSWAPFDKDNYKE
• Gene ID - Mouse: ENSMUSG00000032122
• Gene ID - Rat: ENSRNOG00000039390
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.