Anti SLC36A2 pAb (ATL-HPA044002 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044002-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 36 (proton/amino acid symporter), member 2
Gene Name: SLC36A2
Alternative Gene Name: PAT2, TRAMD1, tramdorin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020264: 53%, ENSRNOG00000011892: 53%
Entrez Gene ID: 153201
Uniprot ID: Q495M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVF
Gene Sequence QGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVF
Gene ID - Mouse ENSMUSG00000020264
Gene ID - Rat ENSRNOG00000011892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC36A2 pAb (ATL-HPA044002 w/enhanced validation)
Datasheet Anti SLC36A2 pAb (ATL-HPA044002 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC36A2 pAb (ATL-HPA044002 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SLC36A2 pAb (ATL-HPA044002 w/enhanced validation)
Datasheet Anti SLC36A2 pAb (ATL-HPA044002 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC36A2 pAb (ATL-HPA044002 w/enhanced validation)