Anti SLC35F4 pAb (ATL-HPA043853)

Atlas Antibodies

Catalog No.:
ATL-HPA043853-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35, member F4
Gene Name: SLC35F4
Alternative Gene Name: C14orf36, FLJ37712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021852: 85%, ENSRNOG00000014982: 83%
Entrez Gene ID: 341880
Uniprot ID: A4IF30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA
Gene Sequence EEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA
Gene ID - Mouse ENSMUSG00000021852
Gene ID - Rat ENSRNOG00000014982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35F4 pAb (ATL-HPA043853)
Datasheet Anti SLC35F4 pAb (ATL-HPA043853) Datasheet (External Link)
Vendor Page Anti SLC35F4 pAb (ATL-HPA043853) at Atlas Antibodies

Documents & Links for Anti SLC35F4 pAb (ATL-HPA043853)
Datasheet Anti SLC35F4 pAb (ATL-HPA043853) Datasheet (External Link)
Vendor Page Anti SLC35F4 pAb (ATL-HPA043853)