Anti SLC35E1 pAb (ATL-HPA016570)

Atlas Antibodies

Catalog No.: ATL-HPA016570-25

Protein Description: solute carrier family 35, member E1
Gene Name: SLC35E1
Alternative Gene Name: FLJ14251
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019731: 76%, ENSRNOG00000012287: 76%
Entrez Gene ID: 79939
Uniprot ID: Q96K37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV
• Gene Sequence: NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV
• Gene ID - Mouse: ENSMUSG00000019731
• Gene ID - Rat: ENSRNOG00000012287
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.