Anti SLC35E1 pAb (ATL-HPA016570)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016570-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC35E1
Alternative Gene Name: FLJ14251
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019731: 76%, ENSRNOG00000012287: 76%
Entrez Gene ID: 79939
Uniprot ID: Q96K37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV |
| Gene Sequence | NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV |
| Gene ID - Mouse | ENSMUSG00000019731 |
| Gene ID - Rat | ENSRNOG00000012287 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC35E1 pAb (ATL-HPA016570) | |
| Datasheet | Anti SLC35E1 pAb (ATL-HPA016570) Datasheet (External Link) |
| Vendor Page | Anti SLC35E1 pAb (ATL-HPA016570) at Atlas Antibodies |
| Documents & Links for Anti SLC35E1 pAb (ATL-HPA016570) | |
| Datasheet | Anti SLC35E1 pAb (ATL-HPA016570) Datasheet (External Link) |
| Vendor Page | Anti SLC35E1 pAb (ATL-HPA016570) |