Anti SLC35A2 pAb (ATL-HPA036087)

Atlas Antibodies

Catalog No.: ATL-HPA036087-25

Protein Description: solute carrier family 35 (UDP-galactose transporter), member A2
Gene Name: SLC35A2
Alternative Gene Name: UGALT, UGAT, UGT, UGT1, UGT2, UGTL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031156: 89%, ENSRNOG00000024801: 80%
Entrez Gene ID: 7355
Uniprot ID: P78381
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
• Gene Sequence: RGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
• Gene ID - Mouse: ENSMUSG00000031156
• Gene ID - Rat: ENSRNOG00000024801
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC35A2 pAb (ATL-HPA036087) – 2 Found

Stewart, Sarah E; Menzies, Sam A; Popa, Stephanie J; Savinykh, Natalia; Petrunkina Harrison, Anna; Lehner, Paul J; Moreau, Kevin. A genome-wide CRISPR screen reconciles the role of N-linked glycosylation in galectin-3 transport to the cell surface. Journal Of Cell Science. 2017;130(19):3234-3247. 

Liu, Chien-Liang; Cheng, Shih-Ping; Huang, Wen-Chien; Chen, Ming-Jen; Lin, Chi-Hsin; Chen, Shan-Na; Chang, Yuan-Ching. Aberrant Expression of Solute Carrier Family 35 Member A2 Correlates With Tumor Progression in Breast Cancer. In Vivo (Athens, Greece). 2023;37(1):262-269.