Anti SLC30A7 pAb (ATL-HPA018034)

Atlas Antibodies

Catalog No.:
ATL-HPA018034-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 30 (zinc transporter), member 7
Gene Name: SLC30A7
Alternative Gene Name: ZNT7, ZnTL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054414: 87%, ENSRNOG00000013912: 85%
Entrez Gene ID: 148867
Uniprot ID: Q8NEW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQI
Gene Sequence HGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQI
Gene ID - Mouse ENSMUSG00000054414
Gene ID - Rat ENSRNOG00000013912
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC30A7 pAb (ATL-HPA018034)
Datasheet Anti SLC30A7 pAb (ATL-HPA018034) Datasheet (External Link)
Vendor Page Anti SLC30A7 pAb (ATL-HPA018034) at Atlas Antibodies

Documents & Links for Anti SLC30A7 pAb (ATL-HPA018034)
Datasheet Anti SLC30A7 pAb (ATL-HPA018034) Datasheet (External Link)
Vendor Page Anti SLC30A7 pAb (ATL-HPA018034)
Citations for Anti SLC30A7 pAb (ATL-HPA018034) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed