Anti SLC2A12 pAb (ATL-HPA031593)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031593-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC2A12
Alternative Gene Name: GLUT12, GLUT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037490: 87%, ENSRNOG00000011161: 87%
Entrez Gene ID: 154091
Uniprot ID: Q8TD20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR |
| Gene Sequence | PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR |
| Gene ID - Mouse | ENSMUSG00000037490 |
| Gene ID - Rat | ENSRNOG00000011161 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC2A12 pAb (ATL-HPA031593) | |
| Datasheet | Anti SLC2A12 pAb (ATL-HPA031593) Datasheet (External Link) |
| Vendor Page | Anti SLC2A12 pAb (ATL-HPA031593) at Atlas Antibodies |
| Documents & Links for Anti SLC2A12 pAb (ATL-HPA031593) | |
| Datasheet | Anti SLC2A12 pAb (ATL-HPA031593) Datasheet (External Link) |
| Vendor Page | Anti SLC2A12 pAb (ATL-HPA031593) |