Anti SLC2A10 pAb (ATL-HPA041015)

Atlas Antibodies

Catalog No.: ATL-HPA041015-25

Protein Description: solute carrier family 2 (facilitated glucose transporter), member 10
Gene Name: SLC2A10
Alternative Gene Name: GLUT10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027661: 63%, ENSRNOG00000025384: 61%
Entrez Gene ID: 81031
Uniprot ID: O95528
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRG
• Gene Sequence: LPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRG
• Gene ID - Mouse: ENSMUSG00000027661
• Gene ID - Rat: ENSRNOG00000025384
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.