Anti SLC27A4 pAb (ATL-HPA007293)

Atlas Antibodies

Catalog No.: ATL-HPA007293-25

Protein Description: solute carrier family 27 (fatty acid transporter), member 4
Gene Name: SLC27A4
Alternative Gene Name: ACSVL4, FATP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059316: 86%, ENSRNOG00000014369: 80%
Entrez Gene ID: 10999
Uniprot ID: Q6P1M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTG
• Gene Sequence: LLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTG
• Gene ID - Mouse: ENSMUSG00000059316
• Gene ID - Rat: ENSRNOG00000014369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC27A4 pAb (ATL-HPA007293) – 2 Found

Lager, Susanne; Ramirez, Vanessa I; Gaccioli, Francesca; Jang, Brian; Jansson, Thomas; Powell, Theresa L. Protein expression of fatty acid transporter 2 is polarized to the trophoblast basal plasma membrane and increased in placentas from overweight/obese women. Placenta. 2016;40( 27016784):60-6. 

Yen, Meng-Chi; Chou, Shih-Kai; Kan, Jung-Yu; Kuo, Po-Lin; Hou, Ming-Feng; Hsu, Ya-Ling. Solute Carrier Family 27 Member 4 (SLC27A4) Enhances Cell Growth, Migration, and Invasion in Breast Cancer Cells. International Journal Of Molecular Sciences. 2018;19(11)