Anti SLC26A1 pAb (ATL-HPA041654)

Atlas Antibodies

Catalog No.: ATL-HPA041654-25

Protein Description: solute carrier family 26 (anion exchanger), member 1
Gene Name: SLC26A1
Alternative Gene Name: EDM4, SAT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046959: 70%, ENSRNOG00000000041: 71%
Entrez Gene ID: 10861
Uniprot ID: Q9H2B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSETGVGEGGP
• Gene Sequence: DTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSETGVGEGGP
• Gene ID - Mouse: ENSMUSG00000046959
• Gene ID - Rat: ENSRNOG00000000041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC26A1 pAb (ATL-HPA041654) – 1 Found

Andharia, N; Hayashi, M; Matsuda, H. Electrophysiological properties of anion exchangers in the luminal membrane of guinea pig pancreatic duct cells. Pflugers Archiv : European Journal Of Physiology. 2018;470(6):897-907.