Anti SLC25A41 pAb (ATL-HPA043591)

Atlas Antibodies

Catalog No.: ATL-HPA043591-25

Protein Description: solute carrier family 25, member 41
Gene Name: SLC25A41
Alternative Gene Name: APC4, FLJ40442, MGC34725
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011486: 84%, ENSRNOG00000048853: 84%
Entrez Gene ID: 284427
Uniprot ID: Q8N5S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQDTVEGSNPTMRGVLQRILAQQGWLGLYRG
• Gene Sequence: AQDTVEGSNPTMRGVLQRILAQQGWLGLYRG
• Gene ID - Mouse: ENSMUSG00000011486
• Gene ID - Rat: ENSRNOG00000048853
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.