Anti SLC25A38 pAb (ATL-HPA041027)

Atlas Antibodies

Catalog No.: ATL-HPA041027-25

Protein Description: solute carrier family 25, member 38
Gene Name: SLC25A38
Alternative Gene Name: FLJ20551
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032519: 91%, ENSRNOG00000018552: 86%
Entrez Gene ID: 54977
Uniprot ID: Q96DW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLL
• Gene Sequence: TALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLL
• Gene ID - Mouse: ENSMUSG00000032519
• Gene ID - Rat: ENSRNOG00000018552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.