Anti SLC22A2 pAb (ATL-HPA008549 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008549-25

Protein Description: solute carrier family 22 member 2
Gene Name: SLC22A2
Alternative Gene Name: OCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040966: 84%, ENSRNOG00000016625: 77%
Entrez Gene ID: 6582
Uniprot ID: O15244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
• Gene Sequence: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
• Gene ID - Mouse: ENSMUSG00000040966
• Gene ID - Rat: ENSRNOG00000016625
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.