Anti SLC1A6 pAb (ATL-HPA044066)

Atlas Antibodies

Catalog No.: ATL-HPA044066-25

Protein Description: solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Gene Name: SLC1A6
Alternative Gene Name: EAAT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005357: 80%, ENSRNOG00000007509: 80%
Entrez Gene ID: 6511
Uniprot ID: P48664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRN
• Gene Sequence: MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRN
• Gene ID - Mouse: ENSMUSG00000005357
• Gene ID - Rat: ENSRNOG00000007509
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.