Anti SLC1A5 pAb (ATL-HPA035240 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035240-25

Protein Description: solute carrier family 1 (neutral amino acid transporter), member 5
Gene Name: SLC1A5
Alternative Gene Name: AAAT, ASCT2, M7V1, RDRC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001918: 68%, ENSRNOG00000015948: 64%
Entrez Gene ID: 6510
Uniprot ID: Q15758
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
• Gene Sequence: VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
• Gene ID - Mouse: ENSMUSG00000001918
• Gene ID - Rat: ENSRNOG00000015948
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC1A5 pAb (ATL-HPA035240 w/enhanced validation) – 11 Found

Wang, Qian; Hardie, Rae-Anne; Hoy, Andrew J; van Geldermalsen, Michelle; Gao, Dadi; Fazli, Ladan; Sadowski, Martin C; Balaban, Seher; Schreuder, Mark; Nagarajah, Rajini; Wong, Justin J-L; Metierre, Cynthia; Pinello, Natalia; Otte, Nicholas J; Lehman, Melanie L; Gleave, Martin; Nelson, Colleen C; Bailey, Charles G; Ritchie, William; Rasko, John E J; Holst, Jeff. Targeting ASCT2-mediated glutamine uptake blocks prostate cancer growth and tumour development. The Journal Of Pathology. 2015;236(3):278-89. 

Schulte, Michael L; Hight, Matthew R; Ayers, Gregory D; Liu, Qi; Shyr, Yu; Washington, M Kay; Manning, H Charles. Non-Invasive Glutamine PET Reflects Pharmacological Inhibition of BRAF(V600E) In Vivo. Molecular Imaging And Biology. 2017;19(3):421-428. 

Dong, J; Xiao, D; Zhao, Z; Ren, P; Li, C; Hu, Y; Shi, J; Su, H; Wang, L; Liu, H; Li, B; Gao, P; Qing, G. Epigenetic silencing of microRNA-137 enhances ASCT2 expression and tumor glutamine metabolism. Oncogenesis. 2017;6(7):e356. 

Momcilovic, Milica; Bailey, Sean T; Lee, Jason T; Fishbein, Michael C; Braas, Daniel; Go, James; Graeber, Thomas G; Parlati, Francesco; Demo, Susan; Li, Rui; Walser, Tonya C; Gricowski, Michael; Shuman, Robert; Ibarra, Julio; Fridman, Deborah; Phelps, Michael E; Badran, Karam; St John, Maie; Bernthal, Nicholas M; Federman, Noah; Yanagawa, Jane; Dubinett, Steven M; Sadeghi, Saman; Christofk, Heather R; Shackelford, David B. The GSK3 Signaling Axis Regulates Adaptive Glutamine Metabolism in Lung Squamous Cell Carcinoma. Cancer Cell. 2018;33(5):905-921.e5. 

Chung, Chan; Sweha, Stefan R; Pratt, Drew; Tamrazi, Benita; Panwalkar, Pooja; Banda, Adam; Bayliss, Jill; Hawes, Debra; Yang, Fusheng; Lee, Ho-Joon; Shan, Mengrou; Cieslik, Marcin; Qin, Tingting; Werner, Christian K; Wahl, Daniel R; Lyssiotis, Costas A; Bian, Zhiguo; Shotwell, J Brad; Yadav, Viveka Nand; Koschmann, Carl; Chinnaiyan, Arul M; Blüml, Stefan; Judkins, Alexander R; Venneti, Sriram. Integrated Metabolic and Epigenomic Reprograming by H3K27M Mutations in Diffuse Intrinsic Pontine Gliomas. Cancer Cell. 2020;38(3):334-349.e9. 

Jeon, Young Joo; Khelifa, Sihem; Ratnikov, Boris; Scott, David A; Feng, Yongmei; Parisi, Fabio; Ruller, Chelsea; Lau, Eric; Kim, Hyungsoo; Brill, Laurence M; Jiang, Tingting; Rimm, David L; Cardiff, Robert D; Mills, Gordon B; Smith, Jeffrey W; Osterman, Andrei L; Kluger, Yuval; Ronai, Ze'ev A. Regulation of glutamine carrier proteins by RNF5 determines breast cancer response to ER stress-inducing chemotherapies. Cancer Cell. 2015;27(3):354-69. 

Krishnamoorthy, Gnana P; Davidson, Natalie R; Leach, Steven D; Zhao, Zhen; Lowe, Scott W; Lee, Gina; Landa, Iňigo; Nagarajah, James; Saqcena, Mahesh; Singh, Kamini; Wendel, Hans-Guido; Dogan, Snjezana; Tamarapu, Prasanna P; Blenis, John; Ghossein, Ronald A; Knauf, Jeffrey A; Rätsch, Gunnar; Fagin, James A. EIF1AX and RAS Mutations Cooperate to Drive Thyroid Tumorigenesis through ATF4 and c-MYC. Cancer Discovery. 2019;9(2):264-281. 

Okazaki, Shogo; Umene, Kiyoko; Yamasaki, Juntaro; Suina, Kentaro; Otsuki, Yuji; Yoshikawa, Momoko; Minami, Yushi; Masuko, Takashi; Kawaguchi, Sho; Nakayama, Hideki; Banno, Kouji; Aoki, Daisuke; Saya, Hideyuki; Nagano, Osamu. Glutaminolysis-related genes determine sensitivity to xCT-targeted therapy in head and neck squamous cell carcinoma. Cancer Science. 2019;110(11):3453-3463. 

Curnock, Rachel; Calcagni, Alessia; Ballabio, Andrea; Cullen, Peter J. TFEB controls retromer expression in response to nutrient availability. The Journal Of Cell Biology. 2019;218(12):3954-3966. 

Alfarsi, Lutfi H; El Ansari, Rokaya; Craze, Madeleine L; Mohammed, Omar J; Masisi, Brendah K; Ellis, Ian O; Rakha, Emad A; Green, Andrew R. SLC1A5 co-expression with TALDO1 associates with endocrine therapy failure in estrogen receptor-positive breast cancer. Breast Cancer Research And Treatment. 2021;189(2):317-331. 

Miura, Kenji; Koyanagi-Aoi, Michiyo; Maniwa, Yoshimasa; Aoi, Takashi. Chorioallantoic membrane assay revealed the role of TIPARP (2,3,7,8-tetrachlorodibenzo-p-dioxin-inducible poly (ADP-ribose) polymerase) in lung adenocarcinoma-induced angiogenesis. Cancer Cell International. 2023;23(1):34.