Anti SLC1A5 pAb (ATL-HPA035239 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035239-25

Protein Description: solute carrier family 1 (neutral amino acid transporter), member 5
Gene Name: SLC1A5
Alternative Gene Name: AAAT, ASCT2, M7V1, RDRC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001918: 66%, ENSRNOG00000015948: 66%
Entrez Gene ID: 6510
Uniprot ID: Q15758
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
• Gene Sequence: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
• Gene ID - Mouse: ENSMUSG00000001918
• Gene ID - Rat: ENSRNOG00000015948
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC1A5 pAb (ATL-HPA035239 w/enhanced validation) – 1 Found

Sergeeva, Olga; Zhang, Yifan; Kenyon, Jonathan D; Miller-Atkins, Galen A; Wu, Chunying; Iyer, Renuka; Sexton, Sandra; Wojtylak, Patrick; Awadallah, Amad; Xin, Wei; Chan, E Ricky; O'Donnel, James K; Lee, Zhenghong. PET imaging of hepatocellular carcinoma with anti-1-amino-3-[(18)F]fluorocyclobutanecarboxylic acid in comparison with L-[S-methyl-(11)C]methionine. Ejnmmi Research. 2019;9(1):47.