Anti SLC1A4 pAb (ATL-HPA034963)

Atlas Antibodies

Catalog No.: ATL-HPA034963-25

Protein Description: solute carrier family 1 (glutamate/neutral amino acid transporter), member 4
Gene Name: SLC1A4
Alternative Gene Name: ASCT1, SATT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020142: 86%, ENSRNOG00000005248: 81%
Entrez Gene ID: 6509
Uniprot ID: P43007
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA
• Gene Sequence: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA
• Gene ID - Mouse: ENSMUSG00000020142
• Gene ID - Rat: ENSRNOG00000005248
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.