Anti SLC1A3 pAb (ATL-HPA037468 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA037468-25

• 

Protein Description: solute carrier family 1 (glial high affinity glutamate transporter), member 3
Gene Name: SLC1A3
Alternative Gene Name: EA6, EAAT1, GLAST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005360: 93%, ENSRNOG00000016163: 93%
Entrez Gene ID: 6507
Uniprot ID: P43003
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
• Gene Sequence: LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
• Gene ID - Mouse: ENSMUSG00000005360
• Gene ID - Rat: ENSRNOG00000016163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.