Anti SLC16A7 pAb (ATL-HPA005911 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005911-25

Protein Description: solute carrier family 16 (monocarboxylate transporter), member 7
Gene Name: SLC16A7
Alternative Gene Name: MCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020102: 48%, ENSRNOG00000007839: 45%
Entrez Gene ID: 9194
Uniprot ID: O60669
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
• Gene Sequence: GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
• Gene ID - Mouse: ENSMUSG00000020102
• Gene ID - Rat: ENSRNOG00000007839
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC16A7 pAb (ATL-HPA005911 w/enhanced validation) – 2 Found

Lee, Ji Yun; Lee, InKyoung; Chang, Won Jin; Ahn, Su Min; Lim, Sung Hee; Kim, Hae Su; Yoo, Kwai Han; Jung, Ki Sun; Song, Haa-Na; Cho, Jin Hyun; Kim, Sun Young; Kim, Kyoung-Mee; Lee, Soojin; Kim, Seung Tae; Park, Se Hoon; Lee, Jeeyun; Park, Joon Oh; Park, Young Suk; Lim, Ho Yeong; Kang, Won Ki. MCT4 as a potential therapeutic target for metastatic gastric cancer with peritoneal carcinomatosis. Oncotarget. 2016;7(28):43492-43503. 

Labanca, Estefania; Bizzotto, Juan; Sanchis, Pablo; Anselmino, Nicolas; Yang, Jun; Shepherd, Peter D A; Paez, Alejandra; Antico-Arciuch, Valeria; Lage-Vickers, Sofia; Hoang, Anh G; Tang, Ximing; Raso, Maria Gabriela; Titus, Mark; Efstathiou, Eleni; Cotignola, Javier; Araujo, John; Logothetis, Christopher; Vazquez, Elba; Navone, Nora; Gueron, Geraldine. Prostate cancer castrate resistant progression usage of non-canonical androgen receptor signaling and ketone body fuel. Oncogene. 2021;40(44):6284-6298.