Anti SLC13A5 pAb (ATL-HPA044343 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044343-25

Protein Description: solute carrier family 13 (sodium-dependent citrate transporter), member 5
Gene Name: SLC13A5
Alternative Gene Name: NACT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020805: 92%, ENSRNOG00000014870: 92%
Entrez Gene ID: 284111
Uniprot ID: Q86YT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW
• Gene Sequence: SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW
• Gene ID - Mouse: ENSMUSG00000020805
• Gene ID - Rat: ENSRNOG00000014870
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC13A5 pAb (ATL-HPA044343 w/enhanced validation) – 1 Found

Milanese, Chiara; Bombardieri, Cíntia R; Sepe, Sara; Barnhoorn, Sander; Payán-Goméz, César; Caruso, Donatella; Audano, Matteo; Pedretti, Silvia; Vermeij, Wilbert P; Brandt, Renata M C; Gyenis, Akos; Wamelink, Mirjam M; de Wit, Annelieke S; Janssens, Roel C; Leen, René; van Kuilenburg, André B P; Mitro, Nico; Hoeijmakers, Jan H J; Mastroberardino, Pier G. DNA damage and transcription stress cause ATP-mediated redesign of metabolism and potentiation of anti-oxidant buffering. Nature Communications. 2019;10(1):4887.