Anti SLC12A7 pAb (ATL-HPA041652)

Atlas Antibodies

Catalog No.: ATL-HPA041652-25

Protein Description: solute carrier family 12 (potassium/chloride transporter), member 7
Gene Name: SLC12A7
Alternative Gene Name: DKFZP434F076, KCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017756: 84%, ENSRNOG00000016372: 82%
Entrez Gene ID: 10723
Uniprot ID: Q9Y666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV
• Gene Sequence: AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV
• Gene ID - Mouse: ENSMUSG00000017756
• Gene ID - Rat: ENSRNOG00000016372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.