Anti SLC12A6 pAb (ATL-HPA034563)

Atlas Antibodies

Catalog No.: ATL-HPA034563-25

Protein Description: solute carrier family 12 (potassium/chloride transporter), member 6
Gene Name: SLC12A6
Alternative Gene Name: ACCPN, KCC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027130: 94%, ENSRNOG00000005196: 93%
Entrez Gene ID: 9990
Uniprot ID: Q9UHW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE
• Gene Sequence: RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE
• Gene ID - Mouse: ENSMUSG00000027130
• Gene ID - Rat: ENSRNOG00000005196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC12A6 pAb (ATL-HPA034563) – 2 Found

Shiozaki, Atsushi; Takemoto, Kenichi; Ichikawa, Daisuke; Fujiwara, Hitoshi; Konishi, Hirotaka; Kosuga, Toshiyuki; Komatsu, Shuhei; Okamoto, Kazuma; Kishimoto, Mitsuo; Marunaka, Yoshinori; Otsuji, Eigo. The K-Cl cotransporter KCC3 as an independent prognostic factor in human esophageal squamous cell carcinoma. Biomed Research International. 2014( 25110711):936401. 

Steffensen, Annette B; Oernbo, Eva K; Stoica, Anca; Gerkau, Niklas J; Barbuskaite, Dagne; Tritsaris, Katerina; Rose, Christine R; MacAulay, Nanna. Cotransporter-mediated water transport underlying cerebrospinal fluid formation. Nature Communications. 2018;9(1):2167.