Anti SLC12A4 pAb (ATL-HPA041138)

Atlas Antibodies

Catalog No.: ATL-HPA041138-25

Protein Description: solute carrier family 12 (potassium/chloride transporter), member 4
Gene Name: SLC12A4
Alternative Gene Name: KCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017765: 89%, ENSRNOG00000019651: 91%
Entrez Gene ID: 6560
Uniprot ID: Q9UP95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL
• Gene Sequence: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL
• Gene ID - Mouse: ENSMUSG00000017765
• Gene ID - Rat: ENSRNOG00000019651
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC12A4 pAb (ATL-HPA041138) – 1 Found

Steffensen, Annette B; Oernbo, Eva K; Stoica, Anca; Gerkau, Niklas J; Barbuskaite, Dagne; Tritsaris, Katerina; Rose, Christine R; MacAulay, Nanna. Cotransporter-mediated water transport underlying cerebrospinal fluid formation. Nature Communications. 2018;9(1):2167.