Anti SLC10A7 pAb (ATL-HPA039996)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039996-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SLC10A7
Alternative Gene Name: C4orf13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031684: 78%, ENSRNOG00000011991: 78%
Entrez Gene ID: 84068
Uniprot ID: Q0GE19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQL |
| Gene Sequence | LSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQL |
| Gene ID - Mouse | ENSMUSG00000031684 |
| Gene ID - Rat | ENSRNOG00000011991 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC10A7 pAb (ATL-HPA039996) | |
| Datasheet | Anti SLC10A7 pAb (ATL-HPA039996) Datasheet (External Link) |
| Vendor Page | Anti SLC10A7 pAb (ATL-HPA039996) at Atlas Antibodies |
| Documents & Links for Anti SLC10A7 pAb (ATL-HPA039996) | |
| Datasheet | Anti SLC10A7 pAb (ATL-HPA039996) Datasheet (External Link) |
| Vendor Page | Anti SLC10A7 pAb (ATL-HPA039996) |