Anti SLC10A7 pAb (ATL-HPA039996)

Atlas Antibodies

Catalog No.:
ATL-HPA039996-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 10, member 7
Gene Name: SLC10A7
Alternative Gene Name: C4orf13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031684: 78%, ENSRNOG00000011991: 78%
Entrez Gene ID: 84068
Uniprot ID: Q0GE19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQL
Gene Sequence LSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQL
Gene ID - Mouse ENSMUSG00000031684
Gene ID - Rat ENSRNOG00000011991
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC10A7 pAb (ATL-HPA039996)
Datasheet Anti SLC10A7 pAb (ATL-HPA039996) Datasheet (External Link)
Vendor Page Anti SLC10A7 pAb (ATL-HPA039996) at Atlas Antibodies

Documents & Links for Anti SLC10A7 pAb (ATL-HPA039996)
Datasheet Anti SLC10A7 pAb (ATL-HPA039996) Datasheet (External Link)
Vendor Page Anti SLC10A7 pAb (ATL-HPA039996)