Anti SIRT4 pAb (ATL-HPA029692 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029692-25

Protein Description: sirtuin 4
Gene Name: SIRT4
Alternative Gene Name: SIR2L4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029524: 87%, ENSRNOG00000001151: 84%
Entrez Gene ID: 23409
Uniprot ID: Q9Y6E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVR
• Gene Sequence: PCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVR
• Gene ID - Mouse: ENSMUSG00000029524
• Gene ID - Rat: ENSRNOG00000001151
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIRT4 pAb (ATL-HPA029692 w/enhanced validation) – 2 Found

Huang, Guoyu; Cui, Feifei; Yu, Fudong; Lu, Huijun; Zhang, Meng; Tang, Huamei; Peng, Zhihai. Sirtuin-4 (SIRT4) is downregulated and associated with some clinicopathological features in gastric adenocarcinoma. Biomedicine & Pharmacotherapy = Biomedecine & Pharmacotherapie. 2015;72( 26054687):135-9. 

Huang, Guoyu; Lin, Yao; Zhu, Guanbao. SIRT4 is upregulated in breast cancer and promotes the proliferation, migration and invasion of breast cancer cells. International Journal Of Clinical And Experimental Pathology. 10(12):11849-11856.