Anti SIRT4 pAb (ATL-HPA029691 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029691-25

Protein Description: sirtuin 4
Gene Name: SIRT4
Alternative Gene Name: SIR2L4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029524: 88%, ENSRNOG00000001151: 85%
Entrez Gene ID: 23409
Uniprot ID: Q9Y6E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGS
• Gene Sequence: VLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGS
• Gene ID - Mouse: ENSMUSG00000029524
• Gene ID - Rat: ENSRNOG00000001151
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIRT4 pAb (ATL-HPA029691 w/enhanced validation) – 4 Found

Anderson, Kristin A; Huynh, Frank K; Fisher-Wellman, Kelsey; Stuart, J Darren; Peterson, Brett S; Douros, Jonathan D; Wagner, Gregory R; Thompson, J Will; Madsen, Andreas S; Green, Michelle F; Sivley, R Michael; Ilkayeva, Olga R; Stevens, Robert D; Backos, Donald S; Capra, John A; Olsen, Christian A; Campbell, Jonathan E; Muoio, Deborah M; Grimsrud, Paul A; Hirschey, Matthew D. SIRT4 Is a Lysine Deacylase that Controls Leucine Metabolism and Insulin Secretion. Cell Metabolism. 2017;25(4):838-855.e15. 

Hu, Yiwang; Lin, Jiahao; Lin, Yao; Chen, Xuxu; Zhu, Guanbao; Huang, Guoyu. Overexpression of SIRT4 inhibits the proliferation of gastric cancer cells through cell cycle arrest. Oncology Letters. 2019;17(2):2171-2176. 

Chen, Zhouxun; Lin, Jiahao; Feng, Shuyi; Chen, Xuxu; Huang, Hanzhang; Wang, Chen; Yu, Yujun; He, Yu; Han, Shaoliang; Zheng, Linfeng; Huang, Guoyu. SIRT4 inhibits the proliferation, migration, and invasion abilities of thyroid cancer cells by inhibiting glutamine metabolism. Oncotargets And Therapy. 12( 30992675):2397-2408. 

Lei, Ming-Zhu; Li, Xu-Xu; Zhang, Ye; Li, Jin-Tao; Zhang, Fan; Wang, Yi-Ping; Yin, Miao; Qu, Jia; Lei, Qun-Ying. Acetylation promotes BCAT2 degradation to suppress BCAA catabolism and pancreatic cancer growth. Signal Transduction And Targeted Therapy. 2020;5(1):70.