Anti SIGLEC8 pAb (ATL-HPA012556)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012556-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SIGLEC8
Alternative Gene Name: MGC59785, SAF2, SIGLEC-8, SIGLEC8L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 39%, ENSRNOG00000022640: 34%
Entrez Gene ID: 27181
Uniprot ID: Q9NYZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNHNPSSKEVRG |
| Gene Sequence | RSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNHNPSSKEVRG |
| Gene ID - Mouse | ENSMUSG00000030474 |
| Gene ID - Rat | ENSRNOG00000022640 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIGLEC8 pAb (ATL-HPA012556) | |
| Datasheet | Anti SIGLEC8 pAb (ATL-HPA012556) Datasheet (External Link) |
| Vendor Page | Anti SIGLEC8 pAb (ATL-HPA012556) at Atlas Antibodies |
| Documents & Links for Anti SIGLEC8 pAb (ATL-HPA012556) | |
| Datasheet | Anti SIGLEC8 pAb (ATL-HPA012556) Datasheet (External Link) |
| Vendor Page | Anti SIGLEC8 pAb (ATL-HPA012556) |
| Citations for Anti SIGLEC8 pAb (ATL-HPA012556) – 1 Found |
| Youngblood, Bradford A; Leung, John; Falahati, Rustom; Williams, Jason; Schanin, Julia; Brock, Emily C; Singh, Bhupinder; Chang, Alan T; O'Sullivan, Jeremy A; Schleimer, Robert P; Tomasevic, Nenad; Bebbington, Christopher R; Bochner, Bruce S. Discovery, Function, and Therapeutic Targeting of Siglec-8. Cells. 2020;10(1) PubMed |