Anti SIGLEC5 pAb (ATL-HPA009085 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA009085-25

Protein Description: sialic acid binding Ig-like lectin 5
Gene Name: SIGLEC5
Alternative Gene Name: CD170, CD33L2, OB-BP2, SIGLEC-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026219: 28%, ENSRNOG00000007882: 33%
Entrez Gene ID: 8778
Uniprot ID: O15389
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK
• Gene Sequence: KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK
• Gene ID - Mouse: ENSMUSG00000026219
• Gene ID - Rat: ENSRNOG00000007882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.