Anti SIDT1 pAb (ATL-HPA035862 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035862-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SIDT1
Alternative Gene Name: FLJ20174, SID-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022696: 91%, ENSRNOG00000002013: 91%
Entrez Gene ID: 54847
Uniprot ID: Q9NXL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SFGSNDGSGNMVASHPIAASTPEGSNYGTIDESSSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRTKMFLYLSDLSRKDRRIV |
| Gene Sequence | SFGSNDGSGNMVASHPIAASTPEGSNYGTIDESSSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRTKMFLYLSDLSRKDRRIV |
| Gene ID - Mouse | ENSMUSG00000022696 |
| Gene ID - Rat | ENSRNOG00000002013 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIDT1 pAb (ATL-HPA035862 w/enhanced validation) | |
| Datasheet | Anti SIDT1 pAb (ATL-HPA035862 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SIDT1 pAb (ATL-HPA035862 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SIDT1 pAb (ATL-HPA035862 w/enhanced validation) | |
| Datasheet | Anti SIDT1 pAb (ATL-HPA035862 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SIDT1 pAb (ATL-HPA035862 w/enhanced validation) |
| Citations for Anti SIDT1 pAb (ATL-HPA035862 w/enhanced validation) – 1 Found |
| Gromov, Pavel; Espinoza, Jaime A; Talman, Maj-Lis; Honma, Naoko; Kroman, Niels; Timmermans Wielenga, Vera; Moreira, José M A; Gromova, Irina. FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast. Plos One. 9(11):e112024. PubMed |