Anti SIAE pAb (ATL-HPA038052)

Atlas Antibodies

Catalog No.:
ATL-HPA038052-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sialic acid acetylesterase
Gene Name: SIAE
Alternative Gene Name: CSE-C, LSE, MGC87009, YSG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001942: 92%, ENSRNOG00000031266: 92%
Entrez Gene ID: 54414
Uniprot ID: Q9HAT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLN
Gene Sequence IRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLN
Gene ID - Mouse ENSMUSG00000001942
Gene ID - Rat ENSRNOG00000031266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIAE pAb (ATL-HPA038052)
Datasheet Anti SIAE pAb (ATL-HPA038052) Datasheet (External Link)
Vendor Page Anti SIAE pAb (ATL-HPA038052) at Atlas Antibodies

Documents & Links for Anti SIAE pAb (ATL-HPA038052)
Datasheet Anti SIAE pAb (ATL-HPA038052) Datasheet (External Link)
Vendor Page Anti SIAE pAb (ATL-HPA038052)