Anti SIAE pAb (ATL-HPA038052)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038052-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SIAE
Alternative Gene Name: CSE-C, LSE, MGC87009, YSG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001942: 92%, ENSRNOG00000031266: 92%
Entrez Gene ID: 54414
Uniprot ID: Q9HAT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLN |
| Gene Sequence | IRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLN |
| Gene ID - Mouse | ENSMUSG00000001942 |
| Gene ID - Rat | ENSRNOG00000031266 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIAE pAb (ATL-HPA038052) | |
| Datasheet | Anti SIAE pAb (ATL-HPA038052) Datasheet (External Link) |
| Vendor Page | Anti SIAE pAb (ATL-HPA038052) at Atlas Antibodies |
| Documents & Links for Anti SIAE pAb (ATL-HPA038052) | |
| Datasheet | Anti SIAE pAb (ATL-HPA038052) Datasheet (External Link) |
| Vendor Page | Anti SIAE pAb (ATL-HPA038052) |