Anti SHROOM1 pAb (ATL-HPA037691)

Atlas Antibodies

Catalog No.:
ATL-HPA037691-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: shroom family member 1
Gene Name: SHROOM1
Alternative Gene Name: APXL2, KIAA1960
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018387: 51%, ENSRNOG00000007431: 51%
Entrez Gene ID: 134549
Uniprot ID: Q2M3G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VREVLVRALPVEELRVYCALLAGKAAVLAQQRNLDERIRLLQDQLDAIRDDLGHHAPSPSPARPPGTCPPVQPPFPLLLT
Gene Sequence VREVLVRALPVEELRVYCALLAGKAAVLAQQRNLDERIRLLQDQLDAIRDDLGHHAPSPSPARPPGTCPPVQPPFPLLLT
Gene ID - Mouse ENSMUSG00000018387
Gene ID - Rat ENSRNOG00000007431
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SHROOM1 pAb (ATL-HPA037691)
Datasheet Anti SHROOM1 pAb (ATL-HPA037691) Datasheet (External Link)
Vendor Page Anti SHROOM1 pAb (ATL-HPA037691) at Atlas Antibodies

Documents & Links for Anti SHROOM1 pAb (ATL-HPA037691)
Datasheet Anti SHROOM1 pAb (ATL-HPA037691) Datasheet (External Link)
Vendor Page Anti SHROOM1 pAb (ATL-HPA037691)