Anti SHROOM1 pAb (ATL-HPA037691)

Atlas Antibodies

Catalog No.: ATL-HPA037691-25

Protein Description: shroom family member 1
Gene Name: SHROOM1
Alternative Gene Name: APXL2, KIAA1960
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018387: 51%, ENSRNOG00000007431: 51%
Entrez Gene ID: 134549
Uniprot ID: Q2M3G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VREVLVRALPVEELRVYCALLAGKAAVLAQQRNLDERIRLLQDQLDAIRDDLGHHAPSPSPARPPGTCPPVQPPFPLLLT
• Gene Sequence: VREVLVRALPVEELRVYCALLAGKAAVLAQQRNLDERIRLLQDQLDAIRDDLGHHAPSPSPARPPGTCPPVQPPFPLLLT
• Gene ID - Mouse: ENSMUSG00000018387
• Gene ID - Rat: ENSRNOG00000007431
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.