Anti SHOC2 pAb (ATL-HPA009164)

Atlas Antibodies

Catalog No.: ATL-HPA009164-25

Protein Description: soc-2 suppressor of clear homolog (C. elegans)
Gene Name: SHOC2
Alternative Gene Name: KIAA0862, SOC-2, SOC2, SUR-8, SUR8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024976: 99%, ENSRNOG00000015339: 100%
Entrez Gene ID: 8036
Uniprot ID: Q9UQ13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
• Gene Sequence: LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
• Gene ID - Mouse: ENSMUSG00000024976
• Gene ID - Rat: ENSRNOG00000015339
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SHOC2 pAb (ATL-HPA009164) – 1 Found

Yi, Jing; Chen, Muyun; Wu, Xiaohui; Yang, Xiao; Xu, Tian; Zhuang, Yuan; Han, Min; Xu, Rener. Endothelial SUR-8 acts in an ERK-independent pathway during atrioventricular cushion development. Developmental Dynamics : An Official Publication Of The American Association Of Anatomists. 2010;239(7):2005-13.