Anti SHISA5 pAb (ATL-HPA042295)

Atlas Antibodies

Catalog No.:
ATL-HPA042295-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: shisa family member 5
Gene Name: SHISA5
Alternative Gene Name: hShisa5, SCOTIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025647: 53%, ENSRNOG00000020667: 50%
Entrez Gene ID: 51246
Uniprot ID: Q8N114
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMS
Gene Sequence EVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMS
Gene ID - Mouse ENSMUSG00000025647
Gene ID - Rat ENSRNOG00000020667
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SHISA5 pAb (ATL-HPA042295)
Datasheet Anti SHISA5 pAb (ATL-HPA042295) Datasheet (External Link)
Vendor Page Anti SHISA5 pAb (ATL-HPA042295) at Atlas Antibodies

Documents & Links for Anti SHISA5 pAb (ATL-HPA042295)
Datasheet Anti SHISA5 pAb (ATL-HPA042295) Datasheet (External Link)
Vendor Page Anti SHISA5 pAb (ATL-HPA042295)