Anti SHE pAb (ATL-HPA037417)

Atlas Antibodies

Catalog No.:
ATL-HPA037417-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Src homology 2 domain containing E
Gene Name: SHE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046280: 84%, ENSRNOG00000020797: 86%
Entrez Gene ID: 126669
Uniprot ID: Q5VZ18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPY
Gene Sequence PYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPY
Gene ID - Mouse ENSMUSG00000046280
Gene ID - Rat ENSRNOG00000020797
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SHE pAb (ATL-HPA037417)
Datasheet Anti SHE pAb (ATL-HPA037417) Datasheet (External Link)
Vendor Page Anti SHE pAb (ATL-HPA037417) at Atlas Antibodies

Documents & Links for Anti SHE pAb (ATL-HPA037417)
Datasheet Anti SHE pAb (ATL-HPA037417) Datasheet (External Link)
Vendor Page Anti SHE pAb (ATL-HPA037417)