Anti SHE pAb (ATL-HPA037417)

Atlas Antibodies

Catalog No.: ATL-HPA037417-25

Protein Description: Src homology 2 domain containing E
Gene Name: SHE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046280: 84%, ENSRNOG00000020797: 86%
Entrez Gene ID: 126669
Uniprot ID: Q5VZ18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPY
• Gene Sequence: PYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPY
• Gene ID - Mouse: ENSMUSG00000046280
• Gene ID - Rat: ENSRNOG00000020797
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.